Lineage for d1ftfb_ (1ftf B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222432Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1222433Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1222439Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
  6. 1222440Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 1222452Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64421] (3 PDB entries)
  8. 1222457Domain d1ftfb_: 1ftf B: [60026]

Details for d1ftfb_

PDB Entry: 1ftf (more details), 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 2)
PDB Compounds: (B:) acyl carrier protein synthase

SCOPe Domain Sequences for d1ftfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftfb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

SCOPe Domain Coordinates for d1ftfb_:

Click to download the PDB-style file with coordinates for d1ftfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ftfb_: