Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) |
Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) |
Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
Species Streptococcus pneumoniae [TaxId:1313] [64421] (3 PDB entries) |
Domain d1ftfb_: 1ftf B: [60026] |
PDB Entry: 1ftf (more details), 2.05 Å
SCOP Domain Sequences for d1ftfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftfb_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae} mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee
Timeline for d1ftfb_: