SCOP 1.67: Domain d1ftec_: 1fte C:

Lineage for d1ftec_ (1fte C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
   forms trimers with three closely packed beta-sheets similar to the IspF trimers

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [64421] (3 PDB entries)

8. Domain d1ftec_: 1fte C: [60024]
   complexed with so4

Details for d1ftec_

PDB Entry: 1fte, 2.4 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 1)

SCOP Domain Sequences for d1ftec_:

Sequence, based on SEQRES records:

>d1ftec_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Sequence, based on observed residues (ATOM records):

>d1ftec_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Timeline for d1ftec_:

• d1ftec_ first appeared in SCOP 1.57
  
• d1ftec_ appears in SCOP 1.65
  
• d1ftec_ appears in SCOP 1.69
  
• d1ftec_ appears in the current release, SCOPe 2.08