Lineage for d1ftea_ (1fte A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419815Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 419816Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 419822Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
  6. 419823Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 419835Species Streptococcus pneumoniae [TaxId:1313] [64421] (3 PDB entries)
  8. 419842Domain d1ftea_: 1fte A: [60022]

Details for d1ftea_

PDB Entry: 1fte (more details), 2.4 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 1)

SCOP Domain Sequences for d1ftea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftea_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

SCOP Domain Coordinates for d1ftea_:

Click to download the PDB-style file with coordinates for d1ftea_.
(The format of our PDB-style files is described here.)

Timeline for d1ftea_: