Lineage for d1ftec_ (1fte C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84726Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
  4. 84727Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
  5. 84733Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
  6. 84734Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 84746Species Streptococcus pneumoniae [TaxId:1313] [64421] (3 PDB entries)
  8. 84755Domain d1ftec_: 1fte C: [60024]

Details for d1ftec_

PDB Entry: 1fte (more details), 2.4 Å

PDB Description: crystal structure of streptococcus pneumoniae acyl carrier protein synthase (native 1)

SCOP Domain Sequences for d1ftec_:

Sequence, based on SEQRES records: (download)

>d1ftec_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgisklgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

Sequence, based on observed residues (ATOM records): (download)

>d1ftec_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Streptococcus pneumoniae}
mivghgidieelasiesavtrhegfakrvltalemerftslkgrrqieylagrwsakeaf
skamgtgfqdlevlnnergapyfsqapfsgkiwlsishtdqfvtasvilee

SCOP Domain Coordinates for d1ftec_:

Click to download the PDB-style file with coordinates for d1ftec_.
(The format of our PDB-style files is described here.)

Timeline for d1ftec_: