Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (5 proteins) |
Protein Isoflavone O-methyltransferase [64114] (1 species) |
Species Alfalfa (Medicago sativa) [TaxId:3879] [64115] (2 PDB entries) |
Domain d1fp2a2: 1fp2 A:109-352 [59942] Other proteins in same PDB: d1fp2a1 complexed with hmo, sah |
PDB Entry: 1fp2 (more details), 1.4 Å
SCOPe Domain Sequences for d1fp2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndam asdsklinlalrdcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenls gsnnltyvggdmftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiid mvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgflsli eiyp
Timeline for d1fp2a2: