Lineage for d1fp2a2 (1fp2 A:109-352)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 999652Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (5 proteins)
  6. 999678Protein Isoflavone O-methyltransferase [64114] (1 species)
  7. 999679Species Alfalfa (Medicago sativa) [TaxId:3879] [64115] (2 PDB entries)
  8. 999680Domain d1fp2a2: 1fp2 A:109-352 [59942]
    Other proteins in same PDB: d1fp2a1
    complexed with hmo, sah

Details for d1fp2a2

PDB Entry: 1fp2 (more details), 1.4 Å

PDB Description: crystal structure analysis of isoflavone o-methyltransferase
PDB Compounds: (A:) isoflavone o-methyltransferase

SCOPe Domain Sequences for d1fp2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndam
asdsklinlalrdcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenls
gsnnltyvggdmftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiid
mvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgflsli
eiyp

SCOPe Domain Coordinates for d1fp2a2:

Click to download the PDB-style file with coordinates for d1fp2a2.
(The format of our PDB-style files is described here.)

Timeline for d1fp2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fp2a1