Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein MJ0307, thioredoxin/glutaredoxin-like protein [64054] (1 species) single-domain PDI |
Species Methanococcus jannaschii [TaxId:2190] [64055] (1 PDB entry) |
Domain d1fo5a_: 1fo5 A: [59922] |
PDB Entry: 1fo5 (more details)
SCOPe Domain Sequences for d1fo5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Methanococcus jannaschii [TaxId: 2190]} mskvkielftspmcphcpaakrvveevanempdaveveyinvmenpqkameygimavpti vingdvefigaptkealveaikkrl
Timeline for d1fo5a_: