Lineage for d1fnga1 (1fng A:82-182)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784786Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 784881Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 784882Domain d1fnga1: 1fng A:82-182 [59904]
    Other proteins in same PDB: d1fnga2, d1fngb1, d1fngb2, d1fngc2, d1fngd1, d1fngd2

Details for d1fnga1

PDB Entry: 1fng (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (A:) protein (MHC class II I-ek, alpha chain)

SCOP Domain Sequences for d1fnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOP Domain Coordinates for d1fnga1:

Click to download the PDB-style file with coordinates for d1fnga1.
(The format of our PDB-style files is described here.)

Timeline for d1fnga1: