SCOP 1.75: Domain d1fngb1: 1fng B:93-188

Lineage for d1fngb1 (1fng B:93-188)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1fngb1: 1fng B:93-188 [59906]
   Other proteins in same PDB: d1fnga1, d1fnga2, d1fngb2, d1fngc1, d1fngc2, d1fngd2
   contains covalently bound peptides at the N-termini of chains B and D

Details for d1fngb1

PDB Entry: 1fng, 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (B:) protein (MHC class II I-ek, beta chain)

SCOP Domain Sequences for d1fngb1:

Sequence; same for both SEQRES and ATOM records:

>d1fngb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1fngb1:

• d1fngb1 first appeared in SCOP 1.57
  
• d1fngb1 appears in SCOP 1.73
  
• d1fngb1 appears in SCOPe 2.01
  
• d1fngb1 appears in the current release, SCOPe 2.08