Lineage for d1fnec2 (1fne C:1-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198540Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 1198544Domain d1fnec2: 1fne C:1-81 [59901]
    Other proteins in same PDB: d1fnea1, d1fneb1, d1fneb2, d1fnec1, d1fned1, d1fned2
    complexed with nag

Details for d1fnec2

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (C:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnec2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOPe Domain Coordinates for d1fnec2:

Click to download the PDB-style file with coordinates for d1fnec2.
(The format of our PDB-style files is described here.)

Timeline for d1fnec2: