Lineage for d1fned2 (1fne D:4-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198665Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 1198669Domain d1fned2: 1fne D:4-92 [59903]
    Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb1, d1fnec1, d1fnec2, d1fned1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1fned2

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (D:) protein (MHC class II I-ek, beta chain)

SCOPe Domain Sequences for d1fned2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fned2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvp

SCOPe Domain Coordinates for d1fned2:

Click to download the PDB-style file with coordinates for d1fned2.
(The format of our PDB-style files is described here.)

Timeline for d1fned2: