Lineage for d1fnec2 (1fne C:1-81)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131977Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)
  7. 132054Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (5 PDB entries)
  8. 132061Domain d1fnec2: 1fne C:1-81 [59901]
    Other proteins in same PDB: d1fnea1, d1fneb1, d1fnec1, d1fned1

Details for d1fnec2

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fnec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnec2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1fnec2:

Click to download the PDB-style file with coordinates for d1fnec2.
(The format of our PDB-style files is described here.)

Timeline for d1fnec2: