Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (5 PDB entries) |
Domain d1fnec2: 1fne C:1-81 [59901] Other proteins in same PDB: d1fnea1, d1fneb1, d1fnec1, d1fned1 |
PDB Entry: 1fne (more details), 1.9 Å
SCOP Domain Sequences for d1fnec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnec2 d.19.1.1 (C:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK} ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal aniavdkanldvmkersnntp
Timeline for d1fnec2: