Lineage for d1fned1 (1fne D:93-188)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103536Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)
  7. 103613Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (5 PDB entries)
  8. 103621Domain d1fned1: 1fne D:93-188 [59902]
    Other proteins in same PDB: d1fnea2, d1fneb2, d1fnec2, d1fned2

Details for d1fned1

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1fned1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fned1 b.1.1.2 (D:93-188) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1fned1:

Click to download the PDB-style file with coordinates for d1fned1.
(The format of our PDB-style files is described here.)

Timeline for d1fned1: