Lineage for d1fi6a_ (1fi6 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914920Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (3 proteins)
  6. 914933Protein Reps1 [63548] (1 species)
  7. 914934Species Mouse (Mus musculus) [TaxId:10090] [63549] (1 PDB entry)
  8. 914935Domain d1fi6a_: 1fi6 A: [59849]
    complexed with ca

Details for d1fi6a_

PDB Entry: 1fi6 (more details)

PDB Description: solution structure of the reps1 eh domain
PDB Compounds: (A:) eh domain protein reps1

SCOPe Domain Sequences for d1fi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}
wkitdeqrqyyvnqfktiqpdlngfipgsaakefftksklpilelshiwelsdfdkdgal
tldefcaafhlvvarkngydlpeklpeslmpk

SCOPe Domain Coordinates for d1fi6a_:

Click to download the PDB-style file with coordinates for d1fi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi6a_: