Lineage for d1fi6a_ (1fi6 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47792Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (3 proteins)
  6. 47804Protein Reps1 [63548] (1 species)
  7. 47805Species Mouse (Mus musculus) [TaxId:10090] [63549] (1 PDB entry)
  8. 47806Domain d1fi6a_: 1fi6 A: [59849]

Details for d1fi6a_

PDB Entry: 1fi6 (more details)

PDB Description: solution structure of the reps1 eh domain

SCOP Domain Sequences for d1fi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus)}
wkitdeqrqyyvnqfktiqpdlngfipgsaakefftksklpilelshiwelsdfdkdgal
tldefcaafhlvvarkngydlpeklpeslmpk

SCOP Domain Coordinates for d1fi6a_:

Click to download the PDB-style file with coordinates for d1fi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi6a_: