Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c551 [46660] (4 species) |
Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries) |
Domain d1fi3a_: 1fi3 A: [59846] complexed with hec; mutant |
PDB Entry: 1fi3 (more details)
SCOPe Domain Sequences for d1fi3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]} qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip hppnpvteeeakilaewvlslk
Timeline for d1fi3a_: