Lineage for d1fi3a_ (1fi3 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45047Protein Cytochrome c551 [46660] (4 species)
  7. 45057Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)
  8. 45060Domain d1fi3a_: 1fi3 A: [59846]

Details for d1fi3a_

PDB Entry: 1fi3 (more details)

PDB Description: solution structure of the m61h mutant of pseudomonas stutzeri substrain zobell ferrocytochrome c-551

SCOP Domain Sequences for d1fi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi3a_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
hppnpvteeeakilaewvlslk

SCOP Domain Coordinates for d1fi3a_:

Click to download the PDB-style file with coordinates for d1fi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi3a_: