SCOP 1.73: Domain d1fe8m2: 1fe8 M:108-211

Lineage for d1fe8m2 (1fe8 M:108-211)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
Domain d1fe8m2: 1fe8 M:108-211 [59795]
Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8m1, d1fe8n1

Details for d1fe8m2

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

PDB Compounds: (M:) immunoglobulin igg ru5

SCOP Domain Sequences for d1fe8m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8m2 b.1.1.2 (M:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaapttsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1fe8m2:

Click to download the PDB-style file with coordinates for d1fe8m2.
(The format of our PDB-style files is described here.)

Timeline for d1fe8m2: