SCOP 1.73: Domain d1fe8l1: 1fe8 L:1-107

Lineage for d1fe8l1 (1fe8 L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1fe8l1: 1fe8 L:1-107 [59792]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l2, d1fe8m2, d1fe8n2

Details for d1fe8l1

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

PDB Compounds: (L:) immunoglobulin igg ru5

SCOP Domain Sequences for d1fe8l1:

Sequence; same for both SEQRES and ATOM records:

>d1fe8l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevk

Timeline for d1fe8l1:

• d1fe8l1 first appeared in SCOP 1.57
  
• d1fe8l1 appears in SCOP 1.71
  
• d1fe8l1 appears in SCOP 1.75
  
• d1fe8l1 appears in the current release, SCOPe 2.08