SCOP 1.73: Domain d1fe8h2: 1fe8 H:116-216

Lineage for d1fe8h2 (1fe8 H:116-216)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1fe8h2: 1fe8 H:116-216 [59787]
   Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h1, d1fe8i1, d1fe8j1, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2

Details for d1fe8h2

PDB Entry: 1fe8, 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

PDB Compounds: (H:) immunoglobulin igg ru5

SCOP Domain Sequences for d1fe8h2:

Sequence; same for both SEQRES and ATOM records:

>d1fe8h2 b.1.1.2 (H:116-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
aettapsvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprg

Timeline for d1fe8h2:

• d1fe8h2 first appeared in SCOP 1.57
  
• d1fe8h2 appears in SCOP 1.71
  
• d1fe8h2 appears in SCOP 1.75
  
• d1fe8h2 appears in the current release, SCOPe 2.08