Lineage for d1fd8a_ (1fd8 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192610Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 192611Family d.58.17.1: Metal-binding domain [55009] (7 proteins)
  6. 192612Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 192613Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (4 PDB entries)
  8. 192616Domain d1fd8a_: 1fd8 A: [59770]

Details for d1fd8a_

PDB Entry: 1fd8 (more details)

PDB Description: solution structure of the cu(i) form of the yeast metallochaperone, atx1

SCOP Domain Sequences for d1fd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae)}
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql

SCOP Domain Coordinates for d1fd8a_:

Click to download the PDB-style file with coordinates for d1fd8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd8a_: