Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
Superfamily d.58.17: Metal-binding domain [55008] (1 family) |
Family d.58.17.1: Metal-binding domain [55009] (7 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (4 PDB entries) |
Domain d1fd8a_: 1fd8 A: [59770] |
PDB Entry: 1fd8 (more details)
SCOP Domain Sequences for d1fd8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fd8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae)} maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki kktgkevrsgkql
Timeline for d1fd8a_: