Lineage for d1fd8a_ (1fd8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953870Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2953871Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 2953887Domain d1fd8a_: 1fd8 A: [59770]
    Cu(I) form
    complexed with cu1

Details for d1fd8a_

PDB Entry: 1fd8 (more details)

PDB Description: solution structure of the cu(i) form of the yeast metallochaperone, atx1
PDB Compounds: (A:) atx1 copper chaperone

SCOPe Domain Sequences for d1fd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql

SCOPe Domain Coordinates for d1fd8a_:

Click to download the PDB-style file with coordinates for d1fd8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd8a_: