Class b: All beta proteins [48724] (177 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
Domain d1fc5a2: 1fc5 A:5-177 [59763] Other proteins in same PDB: d1fc5a1, d1fc5a3, d1fc5b1, d1fc5b3 complexed with mg |
PDB Entry: 1fc5 (more details), 2.2 Å
SCOPe Domain Sequences for d1fc5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc5a2 b.103.1.1 (A:5-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} tglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavr ladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngv rftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d1fc5a2: