Lineage for d1f80b_ (1f80 B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263267Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 263268Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 263274Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to tose of IspF
  6. 263275Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 263276Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 263285Domain d1f80b_: 1f80 B: [59684]
    Other proteins in same PDB: d1f80d_, d1f80e_, d1f80f_

Details for d1f80b_

PDB Entry: 1f80 (more details), 2.3 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)

SCOP Domain Sequences for d1f80b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f80b_ d.150.1.2 (B:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl

SCOP Domain Coordinates for d1f80b_:

Click to download the PDB-style file with coordinates for d1f80b_.
(The format of our PDB-style files is described here.)

Timeline for d1f80b_: