![]() | Class a: All alpha proteins [46456] (151 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (5 proteins) |
![]() | Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries) |
![]() | Domain d1f7va1: 1f7v A:484-607 [59676] Other proteins in same PDB: d1f7va2, d1f7va3 |
PDB Entry: 1f7v (more details), 2.9 Å
SCOP Domain Sequences for d1f7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7va1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)} dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp verm
Timeline for d1f7va1: