Lineage for d1f7va1 (1f7v A:484-607)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705922Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 2705923Protein Arginyl-tRNA synthetase (ArgRS) [47333] (2 species)
  7. 2705924Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47334] (3 PDB entries)
  8. 2705926Domain d1f7va1: 1f7v A:484-607 [59676]
    Other proteins in same PDB: d1f7va2, d1f7va3
    protein/RNA complex

Details for d1f7va1

PDB Entry: 1f7v (more details), 2.9 Å

PDB Description: crystal structure of yeast arginyl-trna synthetase complexed with the trnaarg
PDB Compounds: (A:) arginyl-tRNA synthetase

SCOPe Domain Sequences for d1f7va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7va1 a.27.1.1 (A:484-607) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaik
thepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltp
verm

SCOPe Domain Coordinates for d1f7va1:

Click to download the PDB-style file with coordinates for d1f7va1.
(The format of our PDB-style files is described here.)

Timeline for d1f7va1: