| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) ![]() |
| Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) |
| Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries) |
| Domain d1f7la_: 1f7l A: [59666] |
PDB Entry: 1f7l (more details), 1.5 Å
SCOP Domain Sequences for d1f7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7la_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier
Timeline for d1f7la_: