Lineage for d1f7la_ (1f7l A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138413Fold d.150: 4'-phosphopantetheinyl transferase; possibly related to the IspF and YjgF-like superfamilies (SFlink) [56213] (1 superfamily)
  4. 138414Superfamily d.150.1: 4'-phosphopantetheinyl transferase; possibly related to the IspF and YjgF-like superfamilies (SFlink) [56214] (2 families) (S)
  5. 138420Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
  6. 138421Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 138422Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 138423Domain d1f7la_: 1f7l A: [59666]

Details for d1f7la_

PDB Entry: 1f7l (more details), 1.5 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with coenzyme a at 1.5a

SCOP Domain Sequences for d1f7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7la_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
giygiglditelkriasmagrqkrfaeriltrseldqyyelsekrkneflagrfaakeaf
skafgtgigrqlsfqdieirkdqngkpyiictklspaavhvsithtkeyaaaqvvier

SCOP Domain Coordinates for d1f7la_:

Click to download the PDB-style file with coordinates for d1f7la_.
(The format of our PDB-style files is described here.)

Timeline for d1f7la_: