Lineage for d1f45a2 (1f45 A:88-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521676Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 1521677Species Human (Homo sapiens) [TaxId:9606] [63673] (5 PDB entries)
  8. 1521686Domain d1f45a2: 1f45 A:88-211 [59640]
    Other proteins in same PDB: d1f45a1, d1f45b_

Details for d1f45a2

PDB Entry: 1f45 (more details), 2.8 Å

PDB Description: human interleukin-12
PDB Compounds: (A:) interleukin-12 beta chain

SCOPe Domain Sequences for d1f45a2:

Sequence, based on SEQRES records: (download)

>d1f45a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaervrgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffi
rdii

Sequence, based on observed residues (ATOM records): (download)

>d1f45a2 b.1.2.1 (A:88-211) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
giwstdilkdqkepknktflrceaknysgrftcwwlttistdltfsvkssrgssdpqgvt
cgaatlsaeeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii

SCOPe Domain Coordinates for d1f45a2:

Click to download the PDB-style file with coordinates for d1f45a2.
(The format of our PDB-style files is described here.)

Timeline for d1f45a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f45b_