Lineage for d1f1hc1 (1f1h C:1-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1019029Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 1019030Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 1019031Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 1019087Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 1019102Domain d1f1hc1: 1f1h C:1-100 [59576]
    Other proteins in same PDB: d1f1ha2, d1f1hb2, d1f1hc2, d1f1hd2, d1f1he2, d1f1hf2, d1f1hg2, d1f1hh2, d1f1hi2, d1f1hj2, d1f1hk2, d1f1hl2
    complexed with adp, mn, mpd, tl

Details for d1f1hc1

PDB Entry: 1f1h (more details), 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions
PDB Compounds: (C:) protein (glutamine synthetase)

SCOPe Domain Sequences for d1f1hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1hc1 d.15.9.1 (C:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOPe Domain Coordinates for d1f1hc1:

Click to download the PDB-style file with coordinates for d1f1hc1.
(The format of our PDB-style files is described here.)

Timeline for d1f1hc1: