SCOPe 2.01: Domain d1f1hj1: 1f1h J:1-100

Lineage for d1f1hj1 (1f1h J:1-100)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1f1hj1: 1f1h J:1-100 [59590]
   Other proteins in same PDB: d1f1ha2, d1f1hb2, d1f1hc2, d1f1hd2, d1f1he2, d1f1hf2, d1f1hg2, d1f1hh2, d1f1hi2, d1f1hj2, d1f1hk2, d1f1hl2
   complexed with adp, mn, mpd, tl

Details for d1f1hj1

PDB Entry: 1f1h, 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions

PDB Compounds: (J:) protein (glutamine synthetase)

SCOPe Domain Sequences for d1f1hj1:

Sequence; same for both SEQRES and ATOM records:

>d1f1hj1 d.15.9.1 (J:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1f1hj1:

• d1f1hj1 first appeared in SCOP 1.57
  
• d1f1hj1 appears in SCOP 1.75
  
• d1f1hj1 appears in SCOPe 2.02
  
• d1f1hj1 appears in the current release, SCOPe 2.08