Lineage for d1eumb_ (1eum B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702136Protein Non-hem ferritin [63524] (7 species)
  7. 2702155Species Escherichia coli, FtnA [TaxId:562] [63525] (1 PDB entry)
  8. 2702157Domain d1eumb_: 1eum B: [59508]

Details for d1eumb_

PDB Entry: 1eum (more details), 2.05 Å

PDB Description: crystal structure of the e.coli ferritin ecftna
PDB Compounds: (B:) ferritin 1

SCOPe Domain Sequences for d1eumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eumb_ a.25.1.1 (B:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstld

SCOPe Domain Coordinates for d1eumb_:

Click to download the PDB-style file with coordinates for d1eumb_.
(The format of our PDB-style files is described here.)

Timeline for d1eumb_: