Lineage for d1en4d1 (1en4 D:1-90)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350503Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 350634Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 350635Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 350739Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 350750Species Escherichia coli [TaxId:562] [46620] (10 PDB entries)
  8. 350764Domain d1en4d1: 1en4 D:1-90 [59463]
    Other proteins in same PDB: d1en4a2, d1en4b2, d1en4c2, d1en4d2
    complexed with mw1; mutant

Details for d1en4d1

PDB Entry: 1en4 (more details), 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant

SCOP Domain Sequences for d1en4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1en4d1 a.2.11.1 (D:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1en4d1:

Click to download the PDB-style file with coordinates for d1en4d1.
(The format of our PDB-style files is described here.)

Timeline for d1en4d1: