SCOP 1.67: Domain d1en4d2: 1en4 D:91-205

Lineage for d1en4d2 (1en4 D:91-205)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Escherichia coli [TaxId:562] [54722] (10 PDB entries)

8. Domain d1en4d2: 1en4 D:91-205 [59464]
   Other proteins in same PDB: d1en4a1, d1en4b1, d1en4c1, d1en4d1
   complexed with mw1; mutant

Details for d1en4d2

PDB Entry: 1en4, 2 Å

PDB Description: crystal structure analysis of the e. coli manganese superoxide dismutase q146h mutant

SCOP Domain Sequences for d1en4d2:

Sequence; same for both SEQRES and ATOM records:

>d1en4d2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanhdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1en4d2:

• d1en4d2 first appeared in SCOP 1.57
  
• d1en4d2 appears in SCOP 1.65
  
• d1en4d2 appears in SCOP 1.69
  
• d1en4d2 appears in the current release, SCOPe 2.08