SCOP 1.59: Domain d1ek3a_: 1ek3 A:

Lineage for d1ek3a_ (1ek3 A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Kappa-4 VL REC (human) [63650] (1 PDB entry)

8. Domain d1ek3a_: 1ek3 A: [59434]

Details for d1ek3a_

PDB Entry: 1ek3, 1.9 Å

PDB Description: kappa-4 immunoglobulin vl, rec

SCOP Domain Sequences for d1ek3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ek3a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Kappa-4 VL REC (human)}
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

Timeline for d1ek3a_:

• d1ek3a_ first appeared in SCOP 1.57
  
• d1ek3a_ appears in SCOP 1.61
  
• d1ek3a_ appears in the current release, SCOPe 2.08