Lineage for d1ek3a_ (1ek3 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52664Species Kappa-4 VL REC (human) [63650] (1 PDB entry)
  8. 52665Domain d1ek3a_: 1ek3 A: [59434]

Details for d1ek3a_

PDB Entry: 1ek3 (more details), 1.9 Å

PDB Description: kappa-4 immunoglobulin vl, rec

SCOP Domain Sequences for d1ek3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek3a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Kappa-4 VL REC (human)}
divmtqspdslavspgeratinckssqnlldssfdtntlawyqqkpgqppklliywassr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgggtkveikr

SCOP Domain Coordinates for d1ek3a_:

Click to download the PDB-style file with coordinates for d1ek3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ek3a_: