| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1234; structural similarity of the MurF and HprK extends beyond the core. |
Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family) ![]() binds UDP group |
| Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins) |
| Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species) |
| Species Escherichia coli [TaxId:562] [63952] (1 PDB entry) |
| Domain d1e8cb1: 1e8c B:2-103 [59380] Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8cb2, d1e8cb3 complexed with api, cl, uag |
PDB Entry: 1e8c (more details), 2 Å
SCOP Domain Sequences for d1e8cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8cb1 c.98.1.1 (B:2-103) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
drnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaa
iiaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhe
Timeline for d1e8cb1: