Lineage for d1e8cb1 (1e8c B:2-87)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75730Fold c.98: MurE/MurF N-terminal domain [63417] (1 superfamily)
  4. 75731Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family) (S)
  5. 75732Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)
  6. 75737Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species)
  7. 75738Species Escherichia coli [TaxId:562] [63952] (1 PDB entry)
  8. 75740Domain d1e8cb1: 1e8c B:2-87 [59380]
    Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8cb2, d1e8cb3

Details for d1e8cb1

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

SCOP Domain Sequences for d1e8cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8cb1 c.98.1.1 (B:2-87) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
drnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaa
iiaeakdeatdgeiremhgvpviyls

SCOP Domain Coordinates for d1e8cb1:

Click to download the PDB-style file with coordinates for d1e8cb1.
(The format of our PDB-style files is described here.)

Timeline for d1e8cb1: