| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) ![]() has extra strand located between strands 1 and 2 |
| Family c.72.2.1: MurCDEF [53624] (4 proteins) |
| Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64150] (1 species) |
| Species Escherichia coli [TaxId:562] [64151] (1 PDB entry) |
| Domain d1e8cb3: 1e8c B:104-337 [59382] Other proteins in same PDB: d1e8ca1, d1e8ca2, d1e8cb1, d1e8cb2 complexed with api, cl, uag |
PDB Entry: 1e8c (more details), 2 Å
SCOP Domain Sequences for d1e8cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8cb3 c.72.2.1 (B:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
psdnlrlvgvtgtngkttttqllaqwsqllgeisavmgtvgngllgkviptenttgsavd
vqhelaglvdqgatfcamevsshglvqhrvaalkfaasvftnlsrdhldyhgdmehyeaa
kwllysehhcgqaiinaddevgrrwlaklpdavavsmedhinpnchgrwlkatevnyhds
gatirfssswgdgeieshlmgafnvsnlllalatllalgypladllktaarlqp
Timeline for d1e8cb3: