SCOPe 2.02: Domain d1e8ca2: 1e8c A:338-497

Lineage for d1e8ca2 (1e8c A:338-497)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64107] (1 species)

7. Species Escherichia coli [TaxId:562] [64108] (1 PDB entry)

8. Domain d1e8ca2: 1e8c A:338-497 [59378]
   Other proteins in same PDB: d1e8ca1, d1e8ca3, d1e8cb1, d1e8cb3
   complexed with api, cl, uag

Details for d1e8ca2

PDB Entry: 1e8c, 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

PDB Compounds: (A:) udp-n-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase

SCOPe Domain Sequences for d1e8ca2:

Sequence; same for both SEQRES and ATOM records:

>d1e8ca2 c.59.1.1 (A:338-497) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]}
vcgrmevftapgkptvvvdyahtpdalekalqaarlhcagklwcvfgcggdrdkgkrplm
gaiaeefadvavvtddnprteepraiindilagmldaghakvmegraeavtcavmqaken
dvvlvagkghedyqivgnqrldysdrvtvarllgviarsh

Timeline for d1e8ca2:

• d1e8ca2 first appeared in SCOP 1.57
  
• d1e8ca2 appears in SCOPe 2.01
  
• d1e8ca2 appears in SCOPe 2.03
  
• d1e8ca2 appears in the current release, SCOPe 2.08