Lineage for d1e8ca2 (1e8c A:338-497)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72631Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
  4. 72632Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 72633Family c.59.1.1: MurD/MurE/MurF C-terminal domain [53245] (3 proteins)
  6. 72646Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [64107] (1 species)
  7. 72647Species Escherichia coli [TaxId:562] [64108] (1 PDB entry)
  8. 72648Domain d1e8ca2: 1e8c A:338-497 [59378]
    Other proteins in same PDB: d1e8ca1, d1e8ca3, d1e8cb1, d1e8cb3

Details for d1e8ca2

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

SCOP Domain Sequences for d1e8ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ca2 c.59.1.1 (A:338-497) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
vcgrmevftapgkptvvvdyahtpdalekalqaarlhcagklwcvfgcggdrdkgkrplm
gaiaeefadvavvtddnprteepraiindilagmldaghakvmegraeavtcavmqaken
dvvlvagkghedyqivgnqrldysdrvtvarllgviarsh

SCOP Domain Coordinates for d1e8ca2:

Click to download the PDB-style file with coordinates for d1e8ca2.
(The format of our PDB-style files is described here.)

Timeline for d1e8ca2: