Lineage for d1e8ca1 (1e8c A:3-103)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186756Fold c.98: MurF and HprK N-domain-like [63417] (2 superfamilies)
  4. 186757Superfamily c.98.1: MurE/MurF N-terminal domain [63418] (1 family) (S)
  5. 186758Family c.98.1.1: MurE/MurF N-terminal domain [63419] (2 proteins)
  6. 186763Protein UDP-N-acetylmuramyl tripeptide synthetase MurE [63951] (1 species)
  7. 186764Species Escherichia coli [TaxId:562] [63952] (1 PDB entry)
  8. 186765Domain d1e8ca1: 1e8c A:3-103 [59377]
    Other proteins in same PDB: d1e8ca2, d1e8ca3, d1e8cb2, d1e8cb3

Details for d1e8ca1

PDB Entry: 1e8c (more details), 2 Å

PDB Description: structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli

SCOP Domain Sequences for d1e8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ca1 c.98.1.1 (A:3-103) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli}
rnlrdllapwvpdapsralremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaai
iaeakdeatdgeiremhgvpviylsqlnerlsalagrfyhe

SCOP Domain Coordinates for d1e8ca1:

Click to download the PDB-style file with coordinates for d1e8ca1.
(The format of our PDB-style files is described here.)

Timeline for d1e8ca1: