Lineage for d1e7pg3 (1e7p G:251-371)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001296Protein Fumarate reductase [56429] (2 species)
  7. 3001308Species Wolinella succinogenes [TaxId:844] [56431] (6 PDB entries)
  8. 3001321Domain d1e7pg3: 1e7p G:251-371 [59361]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pb1, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pe1, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7ph1, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pk1, d1e7pk2, d1e7pl_
    complexed with f3s, fad, fes, hem, lmt, mla, na, sf4

Details for d1e7pg3

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (G:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1e7pg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7pg3 d.168.1.1 (G:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
meavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelasrdvvsrrmie
hirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaekwapvlpmqhy
s

SCOPe Domain Coordinates for d1e7pg3:

Click to download the PDB-style file with coordinates for d1e7pg3.
(The format of our PDB-style files is described here.)

Timeline for d1e7pg3: