Lineage for d1e7ph1 (1e7p H:107-239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689593Protein Fumarate reductase [46550] (3 species)
  7. 2689610Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)
  8. 2689621Domain d1e7ph1: 1e7p H:107-239 [59362]
    Other proteins in same PDB: d1e7pa1, d1e7pa2, d1e7pa3, d1e7pb2, d1e7pc_, d1e7pd1, d1e7pd2, d1e7pd3, d1e7pe2, d1e7pf_, d1e7pg1, d1e7pg2, d1e7pg3, d1e7ph2, d1e7pi_, d1e7pj1, d1e7pj2, d1e7pj3, d1e7pk2, d1e7pl_
    complexed with f3s, fad, fes, hem, lmt, mla, na, sf4

Details for d1e7ph1

PDB Entry: 1e7p (more details), 3.1 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (H:) Fumarate reductase iron-sulfur subunit

SCOPe Domain Sequences for d1e7ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ph1 a.1.2.1 (H:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOPe Domain Coordinates for d1e7ph1:

Click to download the PDB-style file with coordinates for d1e7ph1.
(The format of our PDB-style files is described here.)

Timeline for d1e7ph1: