PDB entry 1e7p

View 1e7p on RCSB PDB site
Description: quinol:fumarate reductase from wolinella succinogenes
Class: oxidoreductase
Keywords: oxidoreductase, succinate dehydrogenase, respiratory chain, citric acid cycle, flavoprotein, iron- sulphur protein iron- sulphur protein, dihaem cytochrome b
Deposited on 2000-09-01, released 2001-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pa1, d1e7pa2, d1e7pa3
  • Chain 'B':
    Compound: fumarate reductase iron-sulfur protein
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pb1, d1e7pb2
  • Chain 'C':
    Compound: fumarate reductase cytochrome b subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d1e7pc_
  • Chain 'D':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pd1, d1e7pd2, d1e7pd3
  • Chain 'E':
    Compound: fumarate reductase iron-sulfur protein
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pe1, d1e7pe2
  • Chain 'F':
    Compound: fumarate reductase cytochrome b subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d1e7pf_
  • Chain 'G':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pg1, d1e7pg2, d1e7pg3
  • Chain 'H':
    Compound: fumarate reductase iron-sulfur protein
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7ph1, d1e7ph2
  • Chain 'I':
    Compound: fumarate reductase cytochrome b subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d1e7pi_
  • Chain 'J':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pj1, d1e7pj2, d1e7pj3
  • Chain 'K':
    Compound: fumarate reductase iron-sulfur protein
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7pk1, d1e7pk2
  • Chain 'L':
    Compound: fumarate reductase cytochrome b subunit
    Species: Wolinella succinogenes [TaxId:844]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17413 (0-End)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d1e7pl_
  • Heterogens: FAD, MLA, NA, FES, F3S, SF4, HEM, LMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7pA (A:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pA (A:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7pB (B:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e7pC (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pC (C:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e7pD (D:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pD (D:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7pE (E:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e7pF (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pF (F:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrth
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e7pG (G:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pG (G:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7pH (H:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1e7pI (I:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pI (I:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrth
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1e7pJ (J:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pJ (J:)
    mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
    sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
    aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
    aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
    letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
    rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
    wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
    geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
    frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
    tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
    gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7pK (K:)
    mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
    icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvdtgnwfngmsqrves
    wihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkimredfvgaaglnrvv
    rfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqskiaylrrkmvsvn
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1e7pL (L:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrthhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7pL (L:)
    mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
    vtkkfqldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
    gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
    lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
    pnidykyfdykrth