SCOPe 2.08: Domain d1e6pa1: 1e6p A:447-498

Lineage for d1e6pa1 (1e6p A:447-498)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)

8. Domain d1e6pa1: 1e6p A:447-498 [59314]
   Other proteins in same PDB: d1e6pa2, d1e6pa3, d1e6pb2, d1e6pb3
   complexed with gol, so4; mutant

Details for d1e6pa1

PDB Entry: 1e6p, 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q

PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1e6pa1:

Sequence; same for both SEQRES and ATOM records:

>d1e6pa1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv

Timeline for d1e6pa1:

• d1e6pa1 first appeared in SCOP 1.57
  
• d1e6pa1 appears in SCOPe 2.07