Lineage for d1e6pa2 (1e6p A:2-291,A:380-446)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083224Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 2083225Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 2083230Domain d1e6pa2: 1e6p A:2-291,A:380-446 [59315]
    Other proteins in same PDB: d1e6pa1, d1e6pa3, d1e6pb1, d1e6pb3
    complexed with gol, so4; mutant

Details for d1e6pa2

PDB Entry: 1e6p (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1e6pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6pa2 c.1.8.5 (A:2-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
strkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnleca
wdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasra
kfaqscvrimkdygfdgvdidwqypqaaevdgfiaalqeirtllnqqtitdgrqalpyql
tiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyn
alreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyk
akyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1e6pa2:

Click to download the PDB-style file with coordinates for d1e6pa2.
(The format of our PDB-style files is described here.)

Timeline for d1e6pa2: