| Class b: All beta proteins [48724] (180 folds) |
| Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
| Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
| Protein Chitinase B, C-terminal domain [51061] (1 species) |
| Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries) |
| Domain d1e6pb1: 1e6p B:447-499 [59317] Other proteins in same PDB: d1e6pa2, d1e6pa3, d1e6pb2, d1e6pb3 complexed with gol, so4; mutant |
PDB Entry: 1e6p (more details), 1.7 Å
SCOPe Domain Sequences for d1e6pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6pb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1e6pb1: