| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins) automatically mapped to Pfam PF00553 |
| Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species) belongs to subfamily IIb |
| Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries) |
| Domain d1e5ca_: 1e5c A: [59264] XBD1 mutant |
PDB Entry: 1e5c (more details)
SCOPe Domain Sequences for d1e5ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ca_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi [TaxId: 1708]}
tgcsvtatraeewsdgfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags
Timeline for d1e5ca_: