Lineage for d1e5ca_ (1e5c A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767217Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
    automatically mapped to Pfam PF00553
  6. 2767218Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
    belongs to subfamily IIb
  7. 2767219Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)
  8. 2767222Domain d1e5ca_: 1e5c A: [59264]
    XBD1
    mutant

Details for d1e5ca_

PDB Entry: 1e5c (more details)

PDB Description: internal xylan binding domain from c. fimi xyn10a, r262g mutant
PDB Compounds: (A:) xylanase d

SCOPe Domain Sequences for d1e5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ca_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi [TaxId: 1708]}
tgcsvtatraeewsdgfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags

SCOPe Domain Coordinates for d1e5ca_:

Click to download the PDB-style file with coordinates for d1e5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1e5ca_: