Lineage for d1e5ca_ (1e5c A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55326Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 55327Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins)
  6. 55328Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
  7. 55329Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)
  8. 55331Domain d1e5ca_: 1e5c A: [59264]

Details for d1e5ca_

PDB Entry: 1e5c (more details)

PDB Description: internal xylan binding domain from c. fimi xyn10a, r262g mutant

SCOP Domain Sequences for d1e5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ca_ b.2.2.1 (A:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi}
tgcsvtatraeewsdgfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
ngsgntfgvtvmkngssttpaatcags

SCOP Domain Coordinates for d1e5ca_:

Click to download the PDB-style file with coordinates for d1e5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1e5ca_: